Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MQEDIDAGKVSGTKIITHTQIRQELQSKVDVAQARFDANPSKKNKDKLADAQKDLSHAIRDGECLIKGCVPSEYLKK 1C4Q Chain:A ((1-69)) -------TPDCVTGKVEYTKYNDDDTFTVKVGDKELATNRANLQSLLLSAQITGMTVTIKTNACH-NGGGFSEVIFR

General information: TITO was launched using: RESULT: Template: 1C4Q.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 294 -11696 -39.78 -169.51 target 2D structure prediction score : 0.39 Monomeric hydrophicity matching model chain A : 0.68 3D Compatibility (PKB) : -39.78 2D Compatibility (Sec. Struct. Predict.) : 0.39 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.125

(partial model without unconserved sides chains): PDB file : Tito_1C4Q.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1C4Q-query.scw PDB file : Tito_Scwrl_1C4Q.pdb: