Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDFIKVAAAVIKKDDLYLCARRKENKYKYLSKKFEFPGGKVESGETLQEALVREIYEELGVKVCINNELKKVQHEYPDFKVEITFFSCNFVGNYQYVNFDHEEIIWLPAAELALLDWAAADLPIVDLLQQI 3EF5 Chain:B ((21-102)) --WIPVVAGFLRKDGKILVGQRPE------AGQWEFPGGKIENGETPEEALARELNEELGIEAEVGELKLACTHSYGDVGILILFY---------------------------------------------

General information: TITO was launched using: RESULT: Template: 3EF5.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 270 -35070 -129.89 -449.62 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain B : 0.66 3D Compatibility (PKB) : -129.89 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.466

(partial model without unconserved sides chains): PDB file : Tito_3EF5.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3EF5-query.scw PDB file : Tito_Scwrl_3EF5.pdb: