Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--------------------MPIEFIATSKL----PTAFGEFNISVF---QDPVTGEEHVALSKGLENPPTDPVLV-RVHSECLT--------------------GDAFAS---------LKCDCGPQLQATQKLINEAGQGVILYLRQEGRGIGLTNKIRAYALQDQGHDTVDANLLLNLPADARRYDMCSIMLDHLKVK-------------------EVKLITNNPLKIQALKDQGINVVDRVPLTVGRNPFNEQYLKTKRERMAHLYQKDDF
1T8H Chain:A ((4-275))MPDIFQQEARGWLRCGAPPFAGAVAGLTTKHGGESKGPFASLNMGLHVGDDRTDVVNNRRRLAEWLAFPLERWVCCEQVHGADIQKVTKSDRGNGAQDFATAVPGVDGLYTDEAGVLLALCFADCVPIYFVAPS----AGLVGLAHAGWRGTAGGIAGHMVWLWQTREHIAPSDIYVAIGPAIGPCCYTVDDRVVDSLRPTLPPESPLPWRETSPGQYALDLKEANRLQLLAAGVPNSHIYVSERCTSCEEALFFSHRRDRGTTGRMLAFIGRREE


General information:
TITO was launched using:
RESULT:

Template: 1T8H.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 941 6078 6.46 31.01
target 2D structure prediction score : 0.48
Monomeric hydrophicity matching model chain A : 0.63

3D Compatibility (PKB) : 6.46
2D Compatibility (Sec. Struct. Predict.) : 0.48
1D Compatibility (Hydrophobicity) : 0.63
QMean score : 0.238

(partial model without unconserved sides chains):
PDB file : Tito_1T8H.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1T8H-query.scw
PDB file : Tito_Scwrl_1T8H.pdb: