Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ----EWCTVTVFYQG-RTSGYPLPTAKKVGIVQSFPGEGKGYADYQYILDENCDWKEHGR---PWL-------TGMRLETVPF----VAKQKYE 1LO1 Chain:A ((1-90)) AIPKRLCLVC----GDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKALKVGMLKEGVRLDRVRGGRQKYK

General information: TITO was launched using: RESULT: Template: 1LO1.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 270 12355 45.76 174.01 target 2D structure prediction score : 0.62 Monomeric hydrophicity matching model chain A : 0.69 3D Compatibility (PKB) : 45.76 2D Compatibility (Sec. Struct. Predict.) : 0.62 1D Compatibility (Hydrophobicity) : 0.69 QMean score : -0.014

(partial model without unconserved sides chains): PDB file : Tito_1LO1.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1LO1-query.scw PDB file : Tito_Scwrl_1LO1.pdb: