Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence PHFCEVSVSYENANKQKITTATKYVVPPGSVDIAVGSQMYAVTVDETCKRTDSISIPGRFKIDTQGKKL---EGNPTENYIRSVVLQLNHRGLRMVSRPAP 3ERW Chain:F ((124-162)) ---------------------------------------------ELMKEYHIITIPTSFLLNEKGEIEKTKIGPMTAEQLKEW-----------------

General information: TITO was launched using: RESULT: Template: 3ERW.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain F - contact count / total energy / energy per contact / energy per residue : 61 618 10.13 17.17 target 2D structure prediction score : 0.67 Monomeric hydrophicity matching model chain F : 0.57 3D Compatibility (PKB) : 10.13 2D Compatibility (Sec. Struct. Predict.) : 0.67 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.237

(partial model without unconserved sides chains): PDB file : Tito_3ERW.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3ERW-query.scw PDB file : Tito_Scwrl_3ERW.pdb: