Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence FYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRES------FDCLFELLEHY 4GL9 Chain:F ((30-122)) FYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHY

General information: TITO was launched using: RESULT: Template: 4GL9.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain F - contact count / total energy / energy per contact / energy per residue : 249 -25035 -100.54 -329.40 target 2D structure prediction score : 0.75 Monomeric hydrophicity matching model chain F : 0.85 3D Compatibility (PKB) : -100.54 2D Compatibility (Sec. Struct. Predict.) : 0.75 1D Compatibility (Hydrophobicity) : 0.85 QMean score : 0.600

(partial model without unconserved sides chains): PDB file : Tito_4GL9.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4GL9-query.scw PDB file : Tito_Scwrl_4GL9.pdb: