Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMRNIGQAGKILADSG----------------YQGLMKIYPQAQTPRKSSKLKPLTVEDKACNHALS-KERSKVENIFAKVKT---FKMFSTTYRNHRKRFGLRMNL-IAGIINHELGF
3U4V Chain:A ((199-314))NFNIGSLSDQLSKQTLLISQLQVGKNRFSFKFEGRVVYKSSTFQNQQDSKYFFITAQDAN-NQEINMSFWQKVDQSYQTLKVGQYYYFIGGEVKQFKNNLELKFKFGDYQIIPKETL-


General information:
TITO was launched using:
RESULT:

Template: 3U4V.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 332 22800 68.67 239.99
target 2D structure prediction score : 0.20
Monomeric hydrophicity matching model chain A : 0.67

3D Compatibility (PKB) : 68.67
2D Compatibility (Sec. Struct. Predict.) : 0.20
1D Compatibility (Hydrophobicity) : 0.67
QMean score : 0.251

(partial model without unconserved sides chains):
PDB file : Tito_3U4V.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3U4V-query.scw
PDB file : Tito_Scwrl_3U4V.pdb: