Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLNLQFAETMELTEAELQDVRGGNLVNSMGGGGRSGISGWGVPGIYPGWGNQGMSPNRGAFDWTIDLADGLFGRRRR 2L3N Chain:A ((30-47)) ---QQFLEAMESTGGRVRIAI--------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2L3N.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 24 -4280 -178.33 -237.78 target 2D structure prediction score : 0.50 Monomeric hydrophicity matching model chain A : 0.53 3D Compatibility (PKB) : -178.33 2D Compatibility (Sec. Struct. Predict.) : 0.50 1D Compatibility (Hydrophobicity) : 0.53 QMean score : 0.583

(partial model without unconserved sides chains): PDB file : Tito_2L3N.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2L3N-query.scw PDB file : Tito_Scwrl_2L3N.pdb: