Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --MTNFNSNEKFCGKSLKSLSADEMSLIYGASDG-------------------AEPRWTPTPIILKSAAASSKVCISAAVSGIGGLVSYNNDCLG 5AZW Chain:A ((2-95)) GYFVSIDAHAEECFFERVT-SGTKMGLIFEVAEGGFLDIDVEITGPDNKGIYKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIG

General information: TITO was launched using: RESULT: Template: 5AZW.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 244 -11721 -48.04 -160.56 target 2D structure prediction score : 0.33 Monomeric hydrophicity matching model chain A : 0.67 3D Compatibility (PKB) : -48.04 2D Compatibility (Sec. Struct. Predict.) : 0.33 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.114

(partial model without unconserved sides chains): PDB file : Tito_5AZW.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5AZW-query.scw PDB file : Tito_Scwrl_5AZW.pdb: