Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ----MKNEINYLTMAMSLIALA-----MSFLTFQCNLLIVGMCY---GAALVLIIIYIILKINRKTRNKDSNKC-- 2NAX Chain:A ((1-76)) GGSEFSDRSNELEIRGKYVVVPETSQDMAFKCPICKETVTGVYDEESGEWVWKNTIEVNGKYFHSTCYHETSQNSS

General information: TITO was launched using: RESULT: Template: 2NAX.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 135 -10486 -77.67 -169.12 target 2D structure prediction score : 0.40 Monomeric hydrophicity matching model chain A : 0.68 3D Compatibility (PKB) : -77.67 2D Compatibility (Sec. Struct. Predict.) : 0.40 1D Compatibility (Hydrophobicity) : 0.68 QMean score : -0.072

(partial model without unconserved sides chains): PDB file : Tito_2NAX.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2NAX-query.scw PDB file : Tito_Scwrl_2NAX.pdb: