Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -----MVETITIFVLAIFVGYYVVWGVTPALHTPLMAVTNALSSIIVVGAMLQTVGLPVLGVDANVAFQSVNVVSVLGAIAVFLASINIFGGFAVTARMLEMFKPKQKK 5KP7 Chain:B ((25-103)) MSKEQVLKIIKKYTREI----------APELEDSPLEPTDSLKK---------------LGID--SVNRAEIIMMVMEDLSLNIPRIELAGAKN-IGELADLFAAKL--

General information: TITO was launched using: RESULT: Template: 5KP7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 240 -2012 -8.38 -27.19 target 2D structure prediction score : 0.47 Monomeric hydrophicity matching model chain B : 0.61 3D Compatibility (PKB) : -8.38 2D Compatibility (Sec. Struct. Predict.) : 0.47 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.242

(partial model without unconserved sides chains): PDB file : Tito_5KP7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5KP7-query.scw PDB file : Tito_Scwrl_5KP7.pdb: