Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ---------------------------MQQLMIMVTEVGKLEHTCNLLAEVNKGGKVIKVFDYNGNELSMNMDGIVTFNRKRW--ELPVKVDLK----------------------------------------------------------------------------------------------------- 5H35 Chain:C ((1-195)) MYMILELLNIIGIIAFTISGSLKGTNKGLDIFGVVTLGVITSYAGGIIADILLGIYPPQILKELNYLLLSVGISIFVFYFYKWLQTNPIKMIIAISDAVGLSTFATLGASLAYSYGLNPISVGLIAAIVGTGGGVIRDVLVNEIPMVLTKEIYATAALLSGFIYYFTTPYLHHDSLFVAFLGSFLLRILSIKYNF

General information: TITO was launched using: RESULT: Template: 5H35.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 138 -12054 -87.34 -185.44 target 2D structure prediction score : 0.37 Monomeric hydrophicity matching model chain C : 0.42 3D Compatibility (PKB) : -87.34 2D Compatibility (Sec. Struct. Predict.) : 0.37 1D Compatibility (Hydrophobicity) : 0.42 QMean score : 0.135

(partial model without unconserved sides chains): PDB file : Tito_5H35.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5H35-query.scw PDB file : Tito_Scwrl_5H35.pdb: