Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPDENNAMIRILIFISALLFFIRFGNAEDIFNGTILFKNNDWHFVRCSITQDDYLIEAPQEI-FTQFKELQQQQKNYWVSVLAEVNEQQNG-NLILKIEKIDEVHLDETCHLLEALKNFENRE 2Z4I Chain:A ((127-214)) ----------------------------MTLRGMYFYMADAATFTDCATGK-RFMVANNAELERSYLAARGHSEKPVLLSVEGHFTLEGN-PTKVLAPDTAGKFYPNQDCSSL----------

General information: TITO was launched using: RESULT: Template: 2Z4I.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 340 -33539 -98.64 -414.06 target 2D structure prediction score : 0.31 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : -98.64 2D Compatibility (Sec. Struct. Predict.) : 0.31 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.282

(partial model without unconserved sides chains): PDB file : Tito_2Z4I.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2Z4I-query.scw PDB file : Tito_Scwrl_2Z4I.pdb: