Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence------------MTKKNNAPEL----HKYRGLT---STEQMVIHQMLISYVREE--------NCRFNIIM-TGTAEPYNLVKLTSINFENEASAIWVHFETITGEQIALPIDFLSRI-----EFSGQQEI--------------
4B4P Chain:A ((6-147))SAQVTGTLLGTGKTNTTQMPALYTWQHQIYNVNFIPSSSGTLTCQAGTILVWKNGRETQYALECRVSIHHSSGSINESQWGQQSQVGFGTACGN---KKCRFTGFEISLRIPPNAQTYPLSGDLKGSFSLTNKEVNWSASIYVP


General information:
TITO was launched using:
RESULT:

Template: 4B4P.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 267 7110 26.63 75.64
target 2D structure prediction score : 0.38
Monomeric hydrophicity matching model chain A : 0.60

3D Compatibility (PKB) : 26.63
2D Compatibility (Sec. Struct. Predict.) : 0.38
1D Compatibility (Hydrophobicity) : 0.60
QMean score : 0.096

(partial model without unconserved sides chains):
PDB file : Tito_4B4P.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4B4P-query.scw
PDB file : Tito_Scwrl_4B4P.pdb: