Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMTKRTPI-SFEFFPPKTDASAEKLRIVHQELQHLNPEFFSITYGAGGSTRERTLAAIEDFNGKGTPVAPHLSCIGDDKTRIAELLDLYKAQGIDRIVALRGDLPSGQVGLGELP----YAQDLVRFIREHSGDHFHIEVAAYPEMHPQAESLDSDIQRFIEKVQAGANAGITQFFFNPDSYFYFIERLEKAGINIPVAPGIMPITNASNLIRFADGTGAEIPRWIRKQLQAYGDDSESIKAFGHEVVVKLCERLIAGGAPSLHFYSMNQVEPTRQLVVDLGLN
3APY Chain:F ((9-290))-ARRGPLFSFEFFPPKDPEGEEALFRTLEELKAFRPAFVSITYGAMGSTRERSVAWAQRIQSLGLNPLAHLTVAGQSRKEVAEVLHRFVESGVENLLALRGDPPRGERVFRPHPEGFRYAAELVALIRERYGDRVSVGGAAYPEGHPESESLEADLRHFKAKVEAGLDFAITQLFFNNAHYFGFLERARRAGIGIPILPGIMPVTSYRQLRRFTEVCGASIPGPLLAKLERHQDDPKAVLEIGVEHAVRQVAELLEAGVEGVHFYTLNKSPATRMVLERLGLR


General information:
TITO was launched using:
RESULT:

Template: 3APY.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain F - contact count / total energy / energy per contact / energy per residue : 1406 24870 17.69 89.78
target 2D structure prediction score : 0.73
Monomeric hydrophicity matching model chain F : 0.81

3D Compatibility (PKB) : 17.69
2D Compatibility (Sec. Struct. Predict.) : 0.73
1D Compatibility (Hydrophobicity) : 0.81
QMean score : 0.644

(partial model without unconserved sides chains):
PDB file : Tito_3APY.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3APY-query.scw
PDB file : Tito_Scwrl_3APY.pdb: