Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ------------------------MTYVRVGKKW------NYACFILDLFNREILGYSCGEHKDAVLVKKHLAVSNNL-------------------------------------------- 2DST Chain:A ((2-123)) RRAGYLHLYGLNLVFDRVGKGPPVLLVAEEASRWPEALPEGYAFYLLDLPGYGRTEGPRMAPEELAHFVAGFAVMMNLGAPWVLLRGLGLALGPHLEALGLRALPAEGVEVAEVLSSKLSYG

General information: TITO was launched using: RESULT: Template: 2DST.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 157 -13313 -84.79 -277.34 target 2D structure prediction score : 0.58 Monomeric hydrophicity matching model chain A : 0.52 3D Compatibility (PKB) : -84.79 2D Compatibility (Sec. Struct. Predict.) : 0.58 1D Compatibility (Hydrophobicity) : 0.52 QMean score : 0.309

(partial model without unconserved sides chains): PDB file : Tito_2DST.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2DST-query.scw PDB file : Tito_Scwrl_2DST.pdb: