Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence------------------------------------------------MGTYQRSKELKIVLFLSEFSNLLPKADETPLFLCYFIFSTTFFYQRKVDKTIVK------------------------------------------------------------------------------------------------------------------------------------------------------
5CMN Chain:E ((3-260))LCPGLLKGVYQSEHLFESDHQSGAWCKDPLQASDKIYYMPWTPYRTDTLTEYSSKDDFIAGRPTTTYK-LPHRVDGTG----FVVYDGALFFNKERTRNIVKFDLRTRIKSGEAIIANANYHDTSPYRWGGKSDIDLAVDENGLWVIYATEQNNGKIVISQLNPYTLRIEGTWDTAYDKRSASNAFMICGILYVVKSNKIDYIYNTDQSKDSLVDVPFPNSYQYIAAVDYNPRDNLLYVWNNYHVVKYSLDF


General information:
TITO was launched using:
RESULT:

Template: 5CMN.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain E - contact count / total energy / energy per contact / energy per residue : 61 3895 63.85 79.49
target 2D structure prediction score : 0.41
Monomeric hydrophicity matching model chain E : 0.54

3D Compatibility (PKB) : 63.85
2D Compatibility (Sec. Struct. Predict.) : 0.41
1D Compatibility (Hydrophobicity) : 0.54
QMean score : 0.124

(partial model without unconserved sides chains):
PDB file : Tito_5CMN.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5CMN-query.scw
PDB file : Tito_Scwrl_5CMN.pdb: