Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKKMKKYKIRKSGNSDVTTIPPEVK-----EFMGVQTGDAISYVFQSDGSVRMIKAQEEP-DIDSLVDSIMNQYEDALKDLVDL 5K8J Chain:A ((6-85)) HHARATGKTFRSGNSEAVRLPRDLAFGADVELTLIRSGD-VLTIYPSKGSIADLVATLNQMPRP---DSVEIRDEDLFPERPGL

General information: TITO was launched using: RESULT: Template: 5K8J.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 100 6643 66.43 89.77 target 2D structure prediction score : 0.39 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : 66.43 2D Compatibility (Sec. Struct. Predict.) : 0.39 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.410

(partial model without unconserved sides chains): PDB file : Tito_5K8J.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5K8J-query.scw PDB file : Tito_Scwrl_5K8J.pdb: