Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLVEKGKENIYYVNVAKVREDENEWKEFKSRYSINSTPTFTVYREGSIEKTVFWTKESGMSLAEVEEFLDYVSMQQ 2FCH Chain:F ((53-104)) ------------LTVAKLNIDQNPGTA--PKYGIRSIPTLLLFKNGEVAA----TKVGALSKGQLKEFLD------

General information: TITO was launched using: RESULT: Template: 2FCH.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain F - contact count / total energy / energy per contact / energy per residue : 98 -9207 -93.94 -177.05 target 2D structure prediction score : 0.62 Monomeric hydrophicity matching model chain F : 0.70 3D Compatibility (PKB) : -93.94 2D Compatibility (Sec. Struct. Predict.) : 0.62 1D Compatibility (Hydrophobicity) : 0.70 QMean score : 0.408

(partial model without unconserved sides chains): PDB file : Tito_2FCH.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2FCH-query.scw PDB file : Tito_Scwrl_2FCH.pdb: