Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFHGPLNRADAESLLSLCKEGSYLVRLSETNPQDCSLSLRSSQGFLHLKFARTRENQVVLGQHSGPFPSVPELVLHY 1OPK Chain:A ((107-182)) WYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSS-ESRFNTLAELVHHH

General information: TITO was launched using: RESULT: Template: 1OPK.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 272 -39633 -145.71 -521.49 target 2D structure prediction score : 0.70 Monomeric hydrophicity matching model chain A : 0.82 3D Compatibility (PKB) : -145.71 2D Compatibility (Sec. Struct. Predict.) : 0.70 1D Compatibility (Hydrophobicity) : 0.82 QMean score : 0.726

(partial model without unconserved sides chains): PDB file : Tito_1OPK.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1OPK-query.scw PDB file : Tito_Scwrl_1OPK.pdb: