Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence YYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCVSFKNIVYTYRIFREKHGYYRIQTAEGSPKQVFPSLKELISKF 3OV1 Chain:A ((8-83)) WFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLW------VVKFNSLNELVDYH

General information: TITO was launched using: RESULT: Template: 3OV1.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 275 -52480 -190.84 -690.53 target 2D structure prediction score : 0.57 Monomeric hydrophicity matching model chain A : 0.73 3D Compatibility (PKB) : -190.84 2D Compatibility (Sec. Struct. Predict.) : 0.57 1D Compatibility (Hydrophobicity) : 0.73 QMean score : 0.679

(partial model without unconserved sides chains): PDB file : Tito_3OV1.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3OV1-query.scw PDB file : Tito_Scwrl_3OV1.pdb: