Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFEFVMSEQPISPTVQLNTRGLRCPEPVMMLHQAIRKAKSGDVVEVLATDPSTSWDIPKFCMHLGHELLLKEEVLDEQNHKEYRYLVQKG 1JE3 Chain:A ((21-97)) -------MKNIVPDYRLDMVGEPCPYPAVATLEAMPQLKKGEILEVVSDCPQSINNIPLDARNHGYTVLDIQQ-----DGPTIRYLIQK-

General information: TITO was launched using: RESULT: Template: 1JE3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 336 -25251 -75.15 -327.93 target 2D structure prediction score : 0.61 Monomeric hydrophicity matching model chain A : 0.66 3D Compatibility (PKB) : -75.15 2D Compatibility (Sec. Struct. Predict.) : 0.61 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.424

(partial model without unconserved sides chains): PDB file : Tito_1JE3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1JE3-query.scw PDB file : Tito_Scwrl_1JE3.pdb: