Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence---MVGTRHLIYVQHNNEYKVAKYG----------------HWDGLDKNTFEVYQGFNKAPLDSSERFASITSPDSNEGYYQVKFLES-----FDLDNLPS-EEDFI---AQLER-EKN------------
4LQZ Chain:A ((13-143))ENLYFQGQRFEIQQHNETIGSIYFSADYAHIRGIEKGTAKYFIDKVGSKRYLFIEYIPDNVLNCKPDFWKTLKYKKDKVTYYVYLIENLDDEVFHLSALQDMNRIPIDIADDVATMGKSPHQNDRMTLKLN


General information:
TITO was launched using:
RESULT:

Template: 4LQZ.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 343 10744 31.32 119.37
target 2D structure prediction score : 0.71
Monomeric hydrophicity matching model chain A : 0.67

3D Compatibility (PKB) : 31.32
2D Compatibility (Sec. Struct. Predict.) : 0.71
1D Compatibility (Hydrophobicity) : 0.67
QMean score : 0.166

(partial model without unconserved sides chains):
PDB file : Tito_4LQZ.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4LQZ-query.scw
PDB file : Tito_Scwrl_4LQZ.pdb: