Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MMTQFVHYQNKQPRDNRRNV-NLN------DSETMLFDAMSRITGTPI---AIIIREFALRHAIRLIMDTDQSILDRI---MNTGAPEHLQRG------------- 2MXY Chain:A ((1-105)) -ASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYG

General information: TITO was launched using: RESULT: Template: 2MXY.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 351 -7826 -22.29 -99.06 target 2D structure prediction score : 0.44 Monomeric hydrophicity matching model chain A : 0.66 3D Compatibility (PKB) : -22.29 2D Compatibility (Sec. Struct. Predict.) : 0.44 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.184

(partial model without unconserved sides chains): PDB file : Tito_2MXY.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2MXY-query.scw PDB file : Tito_Scwrl_2MXY.pdb: