Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------MSVDKKAAMKRIAELTKSESWQEDKEIV-----AEVQKLGKSMWTEKPKRRTPRK-----------IAIWHDDR-------ILVTGTAEQLSEITGLSKNIIWDRARSLWIDSKGRQFRYVEER----------
1EM8 Chain:A ((1-147))MKNATFYLLDNDTTVDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAYRLDEALWARPAESFVPHNLAGEGPRGGAPVEIAWPQKRSSSRRDILISLRTSFADFATAFTEVVDFVPYEDSLKQLARERYKAYRVAGFNLNTATWK


General information:
TITO was launched using:
RESULT:

Template: 1EM8.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 412 16359 39.71 161.97
target 2D structure prediction score : 0.44
Monomeric hydrophicity matching model chain A : 0.65

3D Compatibility (PKB) : 39.71
2D Compatibility (Sec. Struct. Predict.) : 0.44
1D Compatibility (Hydrophobicity) : 0.65
QMean score : 0.196

(partial model without unconserved sides chains):
PDB file : Tito_1EM8.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1EM8-query.scw
PDB file : Tito_Scwrl_1EM8.pdb: