Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence KCVIKRVFSDGSSVKIPAQPAQSTTISKQAVWVYGNCQPF----PVVLNDGSKLSGEIETPAVTP-----------VESVDEDD----CFELDISGQR------------- 2OR7 Chain:A ((6-112)) ----AVQGLAGHPVTLPCIYSTHLGGIVPMCWGLGECRHSYCIRSLIWTNGYTVTHQRNSRYQLKGNISEGNVSLTIENTVVGDGGPYCCVVEIPGAFHFVDYMLEVKPEL

General information: TITO was launched using: RESULT: Template: 2OR7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 242 -4127 -17.05 -55.03 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : -17.05 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.637

(partial model without unconserved sides chains): PDB file : Tito_2OR7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2OR7-query.scw PDB file : Tito_Scwrl_2OR7.pdb: