Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 4X23 Chain:L ((1-79)) ------------------------DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

General information: TITO was launched using: RESULT: Template: 4X23.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain L - contact count / total energy / energy per contact / energy per residue : 166 -23853 -143.69 -301.94 target 2D structure prediction score : 0.85 Monomeric hydrophicity matching model chain L : 0.91 3D Compatibility (PKB) : -143.69 2D Compatibility (Sec. Struct. Predict.) : 0.85 1D Compatibility (Hydrophobicity) : 0.91 QMean score : 0.565

(partial model without unconserved sides chains): PDB file : Tito_4X23.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4X23-query.scw PDB file : Tito_Scwrl_4X23.pdb: