Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYHGHMSGGQAETLLQAKGEPWTFLVRESLSQPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTVGGLETFD 5EHR Chain:B ((113-217)) WFHGHLSGKEAEKLLTEKGKHGSFLVRES-SHPGDFVLSVRT---------S-KVTHVMIRCQELKYDVGGGERFD

General information: TITO was launched using: RESULT: Template: 5EHR.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 219 -28663 -130.88 -440.97 target 2D structure prediction score : 0.69 Monomeric hydrophicity matching model chain B : 0.82 3D Compatibility (PKB) : -130.88 2D Compatibility (Sec. Struct. Predict.) : 0.69 1D Compatibility (Hydrophobicity) : 0.82 QMean score : 0.628

(partial model without unconserved sides chains): PDB file : Tito_5EHR.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5EHR-query.scw PDB file : Tito_Scwrl_5EHR.pdb: