Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRSGRDKKIAGVCAGVAHYLDMDP----TIVRVIWGVLTC-----CYGAGIVAYIILWIIAPVATDY------- 1TH5 Chain:A ((153-226)) MLELNEENVEKVLNEIRPYLAGTGGGGLQFLMIKGPIVKVRLTGPAAVVRTVRIAVSKKLREKIPSIQIVQLLS

General information: TITO was launched using: RESULT: Template: 1TH5.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 156 -28158 -180.50 -485.48 target 2D structure prediction score : 0.43 Monomeric hydrophicity matching model chain A : 0.60 3D Compatibility (PKB) : -180.50 2D Compatibility (Sec. Struct. Predict.) : 0.43 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.236

(partial model without unconserved sides chains): PDB file : Tito_1TH5.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1TH5-query.scw PDB file : Tito_Scwrl_1TH5.pdb: