Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMSSTLNTRLIWIDLEMTGLDTDNDQIIEIATIITDDHLNVLAE-GPVLAIHQPDRILNAMDEWNTRQHGQSGLIE--RVRR-SKLTARDAELQTLEFLKKWVNPKVSPMCGNSICQDRRFLHRLMPELEQYFHYRNLDVSTVKELSKRWRPEIMSGLKKNASHLAMDDIRDSISELKYYREYFFIMNTDGKD
5CY4 Chain:C ((9-192))MSSTLNTRLIWIDLEMTGLDTDNDQIIEIATIITDDHLNVLAEGPVLAIHQPDRI-LNAMDEWNTR---QHGQSGLIERVRRSKLTARDAELQTLEFLKKWVNPKVSPMCGNSICQDRRFLHRLMPELEQYFHYRNLDVSTVKELSKRWRPEIMSGLKKN-SHLAMDDIRDSISELKYYREYFFIMNT----


General information:
TITO was launched using:
RESULT:

Template: 5CY4.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 828 -27090 -32.72 -151.34
target 2D structure prediction score : 0.64
Monomeric hydrophicity matching model chain C : 0.93

3D Compatibility (PKB) : -32.72
2D Compatibility (Sec. Struct. Predict.) : 0.64
1D Compatibility (Hydrophobicity) : 0.93
QMean score : 0.575

(partial model without unconserved sides chains):
PDB file : Tito_5CY4.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5CY4-query.scw
PDB file : Tito_Scwrl_5CY4.pdb: