Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ---------------------------------MKLEQKIIDLLCE-IPDNVDYTDVAEDLD-----LEDISEIRIKQLRELLTNSDIYTISSC-------------------------------- 5U9N Chain:A ((4-150)) EADYDWRNECLRILNLLRKEQNSFLFENPVLESNDLTEETKNRYKEVIPEACDYITIEKRLNNKNQTIENPHEFE-RLVKLIFSNCMIFNPNSGECKWIYDSAKQSLNKFNNLWNKSNVFLLYSNS

General information: TITO was launched using: RESULT: Template: 5U9N.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 78 5827 74.70 107.90 target 2D structure prediction score : 0.72 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : 74.70 2D Compatibility (Sec. Struct. Predict.) : 0.72 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.470

(partial model without unconserved sides chains): PDB file : Tito_5U9N.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5U9N-query.scw PDB file : Tito_Scwrl_5U9N.pdb: