Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ----MSFWQKLFLADQQHNEHKNQTACVENDCSCKTNEQ------LLSAL---AQATDEDVIKG------------------IKKVLISRGYSRKELNELTQKTSIH------ 5K34 Chain:A ((4-116)) MHIKRELWGNLMVAARSNNLEEVKKILKKGIDPTQTNSYHLNRTPLLAAIEGKAYQTANYLWRKYTFDPNFKDNYGDSPISLLKKQLANPAFKDKEKKQIRALIRGMQEEKIA

General information: TITO was launched using: RESULT: Template: 5K34.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 282 20143 71.43 265.04 target 2D structure prediction score : 0.55 Monomeric hydrophicity matching model chain A : 0.66 3D Compatibility (PKB) : 71.43 2D Compatibility (Sec. Struct. Predict.) : 0.55 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.334

(partial model without unconserved sides chains): PDB file : Tito_5K34.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5K34-query.scw PDB file : Tito_Scwrl_5K34.pdb: