Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --------MIEVTDTAVTSFDDAA---EGIEQSRTDGKGLNESHAKGCKN------------------------------ 3C0F Chain:B ((3-87)) IMDEIVNLQKEVSLEEAERYANIASYGDGILLSVHDSTGYRAPEVYCCGEKPWEVYACNRGANLISVNQFEFYFRIEVEG

General information: TITO was launched using: RESULT: Template: 3C0F.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 43 3716 86.41 95.27 target 2D structure prediction score : 0.46 Monomeric hydrophicity matching model chain B : 0.56 3D Compatibility (PKB) : 86.41 2D Compatibility (Sec. Struct. Predict.) : 0.46 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.147

(partial model without unconserved sides chains): PDB file : Tito_3C0F.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3C0F-query.scw PDB file : Tito_Scwrl_3C0F.pdb: