Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence------MIKKMIYFL---GSLITVLS-----SFIYLKKKKQAEKSEGLSKYQGTWFFSDSQQKQQLQITSDYTFLINGQSLG-TSVVEIDEYRLVVRDQYGFYLIFSYPEQTLYD-ESADTSYKLLSEK-------------
1VCB Chain:C ((63-204))LRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQE


General information:
TITO was launched using:
RESULT:

Template: 1VCB.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 453 8201 18.10 72.58
target 2D structure prediction score : 0.42
Monomeric hydrophicity matching model chain C : 0.63

3D Compatibility (PKB) : 18.10
2D Compatibility (Sec. Struct. Predict.) : 0.42
1D Compatibility (Hydrophobicity) : 0.63
QMean score : 0.245

(partial model without unconserved sides chains):
PDB file : Tito_1VCB.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1VCB-query.scw
PDB file : Tito_Scwrl_1VCB.pdb: