Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTDIAEITQRDREKIKEYVESSKFLTYTMLAERFGISKSYLSLILNGKKTSAEANRIIDSIITMYEL 1Y9Q Chain:A ((11-65)) ---------QIANQLKNLRKSRG-LSLDATAQLTGVSKAMLGQIERGESSPTI--ATLWKIASGLEA

General information: TITO was launched using: RESULT: Template: 1Y9Q.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 174 -24939 -143.32 -453.43 target 2D structure prediction score : 0.84 Monomeric hydrophicity matching model chain A : 0.70 3D Compatibility (PKB) : -143.32 2D Compatibility (Sec. Struct. Predict.) : 0.84 1D Compatibility (Hydrophobicity) : 0.70 QMean score : 0.883

(partial model without unconserved sides chains): PDB file : Tito_1Y9Q.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1Y9Q-query.scw PDB file : Tito_Scwrl_1Y9Q.pdb: