Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------------------------------------------------------------------------MSVSRIIFA---YFPTTAISYKLFATK--RGVVTKFCHNPSFLINGVQ---------------------------------------------------------------
3PMG Chain:A ((1-190))VKIVTVKTKAYPDQKPGTSGLRKRVKVFQSSTNYAENFIQSIISTVEPAQRQEATLVVGGDGRFYMKEAIQLIVRIAAANGIGRLVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNPGGPNGDFGIKFNISNGGPAPEAITDKIFQISKTIEEYAICPDLKVDLGVLGKQQFDLENKFKPFTVEIVDS


General information:
TITO was launched using:
RESULT:

Template: 3PMG.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 79 -5935 -75.12 -138.01
target 2D structure prediction score : 0.44
Monomeric hydrophicity matching model chain A : 0.57

3D Compatibility (PKB) : -75.12
2D Compatibility (Sec. Struct. Predict.) : 0.44
1D Compatibility (Hydrophobicity) : 0.57
QMean score : 0.137

(partial model without unconserved sides chains):
PDB file : Tito_3PMG.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3PMG-query.scw
PDB file : Tito_Scwrl_3PMG.pdb: