Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMHKGIYAGLLGTVILFSACGYKTKNSVKESSAAISTTEVGSTKSTSTTSITNTSTGNVDSQHSQSSIQSFSISSTSE-----MQESTVP-SLP-LENSDKALLFLIAHRSEL---QSDDIVISFYQKIDRDYLFTASSKQIRSQGGSGSVGFYRVSPEGSITMTDANGTPF---------------------------------------------
5UDF Chain:A ((13-223))-DRELKNRVLGMVPQATVSSTQILTDWPELVKRVENH-----PHVTGVAPFTQLQGMLTAQGQVAGIMVTGIDPKYEKNVSIIQNHIVAGSLDSLKKGEFGIVLGKDMADSLGLRLNDSVTLVLPEATPSPAGVVPRFKRFKVVGIF-SVGAEVDSMVGYIALYDASTLLRLPDGAQGVRLKLDDIFAAPQVADDIVKNLPSNFYATNWTYTNLFN


General information:
TITO was launched using:
RESULT:

Template: 5UDF.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 671 1813 2.70 11.77
target 2D structure prediction score : 0.42
Monomeric hydrophicity matching model chain A : 0.62

3D Compatibility (PKB) : 2.70
2D Compatibility (Sec. Struct. Predict.) : 0.42
1D Compatibility (Hydrophobicity) : 0.62
QMean score : 0.081

(partial model without unconserved sides chains):
PDB file : Tito_5UDF.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5UDF-query.scw
PDB file : Tito_Scwrl_5UDF.pdb: