Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceWFHGKLSRREAEALLQ--LNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEG------------------VRW----GFAMLPKLFLNS
1JU5 Chain:A ((2-92))WYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEF-


General information:
TITO was launched using:
RESULT:

Template: 1JU5.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 183 1743 9.52 26.01
target 2D structure prediction score : 0.64
Monomeric hydrophicity matching model chain A : 0.71

3D Compatibility (PKB) : 9.52
2D Compatibility (Sec. Struct. Predict.) : 0.64
1D Compatibility (Hydrophobicity) : 0.71
QMean score : 0.643

(partial model without unconserved sides chains):
PDB file : Tito_1JU5.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1JU5-query.scw
PDB file : Tito_Scwrl_1JU5.pdb: