Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceRGSYLTVKPSELDKHI--AQLEEYLRNPPCKVTIYAPPP---KKGRTQLRTEMG-----FASAGKNEDVPVKIAST---GHTYQCRTDATCEEPV-CHGLPNGWTYDGVYMHTFTELSLEQLKAQKAAQTSRH-----------
2JHB Chain:A ((1-143))-GSMPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQTRFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLHRLDGMGCLEFDEERAQQEDALAQQ


General information:
TITO was launched using:
RESULT:

Template: 2JHB.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 463 29506 63.73 250.05
target 2D structure prediction score : 0.37
Monomeric hydrophicity matching model chain A : 0.71

3D Compatibility (PKB) : 63.73
2D Compatibility (Sec. Struct. Predict.) : 0.37
1D Compatibility (Hydrophobicity) : 0.71
QMean score : 0.195

(partial model without unconserved sides chains):
PDB file : Tito_2JHB.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2JHB-query.scw
PDB file : Tito_Scwrl_2JHB.pdb: