Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence SSSDTDSDSSPDRGLSRMCCVYKIHPGGNIWSTKKGEQAWFRRRFSKYEVMAYDRCNLEWGFSGKPRGLTFEFLWDKEAAADGTC 2EK1 Chain:E ((890-930)) --------------------------------------DEILDFFYGYQVIP-GSVCLKYNEKGMPTGEAMVAFESRDEA-----

General information: TITO was launched using: RESULT: Template: 2EK1.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain E - contact count / total energy / energy per contact / energy per residue : 82 -13694 -167.00 -334.00 target 2D structure prediction score : 0.73 Monomeric hydrophicity matching model chain E : 0.61 3D Compatibility (PKB) : -167.00 2D Compatibility (Sec. Struct. Predict.) : 0.73 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.411

(partial model without unconserved sides chains): PDB file : Tito_2EK1.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2EK1-query.scw PDB file : Tito_Scwrl_2EK1.pdb: