Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSSRSVLMGLANDKQTLDWIEEIGGEQYEAKFTHGTVYGYNKFKCRCEFCKEAKALSNQRAALKRAVKRAVELPYVSHRVGAA 1X9X Chain:B ((90-111)) ------------LPFVQLFLEEIGCTQYLDSFIQ-------------------------------------------------

General information: TITO was launched using: RESULT: Template: 1X9X.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 27 -4643 -171.96 -211.05 target 2D structure prediction score : 0.64 Monomeric hydrophicity matching model chain B : 0.55 3D Compatibility (PKB) : -171.96 2D Compatibility (Sec. Struct. Predict.) : 0.64 1D Compatibility (Hydrophobicity) : 0.55 QMean score : 0.546

(partial model without unconserved sides chains): PDB file : Tito_1X9X.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1X9X-query.scw PDB file : Tito_Scwrl_1X9X.pdb: