Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNMTFIVAVQLKDSIVVAVDNKYLTLKDKEKDHFEEHFSSKLYAWHS--GIITGTGEHYVIDKAVRLFINSADADIEKLPLCLNISRQIREMEVGQHEQIQSSKLLYSQYSENGAKLFAIEPTEETGKYQRTEFKENDLIIWLFNPNIQSISGNLKTLYSNPRPKVSFDRIEDWLDYYISAIAEIYEKQSCIDSWMSGSFDIFFQTEGEYFYKHIQNNPTVHLE 1OFH Chain:G ((1-80)) ---TTIVSVRRNGQVVVGGDGQVSL----G-NTVMKGNARKVRRLYNGKVLAGFAGGTADAFTLFELFERKLEMH--QGHLLKSAVELAK--------------------------------------------------------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 1OFH.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain G - contact count / total energy / energy per contact / energy per residue : 225 -11970 -53.20 -153.46 target 2D structure prediction score : 0.53 Monomeric hydrophicity matching model chain G : 0.58 3D Compatibility (PKB) : -53.20 2D Compatibility (Sec. Struct. Predict.) : 0.53 1D Compatibility (Hydrophobicity) : 0.58 QMean score : 0.193

(partial model without unconserved sides chains): PDB file : Tito_1OFH.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1OFH-query.scw PDB file : Tito_Scwrl_1OFH.pdb: