Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)


Input alignment information:
Query sequenceMFYTPIS-----------CKTTIIDTKKEQKNLFAKKLHHIFSYSERNNYD
1CEU Chain:A ((1-51))MEQAPEDQGPQREPYNDWTLELLEELKNEAVRHFPRIWLHSLGQHIYETYG


General information:
TITO was launched using:
RESULT:

Template: 1CEU.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output 		Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 59 7385 125.17 184.63
target 2D structure prediction score : 0.53
Monomeric hydrophicity matching model chain A : 0.61

3D Compatibility (PKB) : 125.17
2D Compatibility (Sec. Struct. Predict.) : 0.53
1D Compatibility (Hydrophobicity) : 0.61
QMean score : 0.361

(partial model without unconserved sides chains):
PDB file : Tito_1CEU.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1CEU-query.scw
PDB file : Tito_Scwrl_1CEU.pdb: