Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence CYGPISMDFAISKLKKAGNQTGLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENEEYNLSGTKKNFSSLKDLLNCY 1OPK Chain:A ((108-182)) YHGPVSRNAAEYLLS--SGINGSFLVRESESSPGQRSISLRYEG--R-V-YHYRINTASDGKLYVSS-ESRFNTLAELVHHH

General information: TITO was launched using: RESULT: Template: 1OPK.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 264 -38108 -144.35 -508.11 target 2D structure prediction score : 0.77 Monomeric hydrophicity matching model chain A : 0.66 3D Compatibility (PKB) : -144.35 2D Compatibility (Sec. Struct. Predict.) : 0.77 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.661

(partial model without unconserved sides chains): PDB file : Tito_1OPK.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1OPK-query.scw PDB file : Tito_Scwrl_1OPK.pdb: