Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence IMGFVSRSQGRRLLKKTMSGTFLLRFSESSEGGITCSWVEHQDDDKVLIYSVQPYTKEVLQSLPLTEIIRHY 1Y1U Chain:A ((594-663)) ILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSP--DRNLWNLKPFTTRDFSIRSLADRLGDL

General information: TITO was launched using: RESULT: Template: 1Y1U.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 239 -36279 -151.79 -518.27 target 2D structure prediction score : 0.73 Monomeric hydrophicity matching model chain A : 0.78 3D Compatibility (PKB) : -151.79 2D Compatibility (Sec. Struct. Predict.) : 0.73 1D Compatibility (Hydrophobicity) : 0.78 QMean score : 0.708

(partial model without unconserved sides chains): PDB file : Tito_1Y1U.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1Y1U-query.scw PDB file : Tito_Scwrl_1Y1U.pdb: