Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -MEMSFIAQDFDKLN------------IITVLESRT------QAIIRNPMNTRLSSATGSSFNKIVRN 1V1C Chain:A ((1-68)) IFDIYVVTADYLPLGAEQDAITLREGQYVEVLDAAHPLRWLVRTKPTKSSPSRQGWVSPAYLDRRLKL

General information: TITO was launched using: RESULT: Template: 1V1C.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 106 6513 61.44 132.91 target 2D structure prediction score : 0.16 Monomeric hydrophicity matching model chain A : 0.68 3D Compatibility (PKB) : 61.44 2D Compatibility (Sec. Struct. Predict.) : 0.16 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.206

(partial model without unconserved sides chains): PDB file : Tito_1V1C.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1V1C-query.scw PDB file : Tito_Scwrl_1V1C.pdb: