Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSQKLYNMKFAAVYLALIAKVERKGGKAESVHQVTSWLTGYEVSDVLACLDRDVTYGDFFRQAPYYVPERIAITGKICGVRIEEIDDPLMQEIRRLDKLVDWLAKGKTSQQVLEKYEKHK 3CU4 Chain:A ((67-82)) ------------------------MIPPADALKIGEYVVA--------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 3CU4.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 7 -869 -124.07 -54.28 target 2D structure prediction score : 0.88 Monomeric hydrophicity matching model chain A : 0.53 3D Compatibility (PKB) : -124.07 2D Compatibility (Sec. Struct. Predict.) : 0.88 1D Compatibility (Hydrophobicity) : 0.53 QMean score : 0.664

(partial model without unconserved sides chains): PDB file : Tito_3CU4.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3CU4-query.scw PDB file : Tito_Scwrl_3CU4.pdb: