Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence----------------------------------------------------------------------MFVNRLMAILNPIMMGISSGLSVAIYWIGAYVIN--DAAPIARLPFFSDMIVFMSYAM--------------------------------------------------------------
1IWP Chain:B ((11-194))FTLKTREGGVASADERADEVVIGVGPAFDKHQHHTLIDMPHGAILKELIAGVEEEGLHARVVRILRTSDVSFMAWDAANLS------GSGIGIGIQSKGTTVIHQRDLLPLSNLELFSQAPLLTLETYRQIGKNAARYARKESPSPVPVVNDQMVRPKFMAKAALFHIKETKHVVQDAEPVTLHIDLVRE


General information:
TITO was launched using:
RESULT:

Template: 1IWP.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 92 -5120 -55.65 -102.40
target 2D structure prediction score : 0.58
Monomeric hydrophicity matching model chain B : 0.59

3D Compatibility (PKB) : -55.65
2D Compatibility (Sec. Struct. Predict.) : 0.58
1D Compatibility (Hydrophobicity) : 0.59
QMean score : 0.058

(partial model without unconserved sides chains):
PDB file : Tito_1IWP.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1IWP-query.scw
PDB file : Tito_Scwrl_1IWP.pdb: