Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --------MTNFNSNEKFCGKSLKS----LSADEMSLIYGASDGAEPRWTPTPIILKSAAASSKVCISAAVSGIGGLVSYNNDCLG------- 2ZYZ Chain:A ((1-93)) MDVLQEQVFKDLKSRGFKIIEQLDDKIFIAEKKERYLFYVMVEGVEVTIQTLLSVINMGETLSMPVVLALVSNDGTVTYYYVRKIRLPRNIYA

General information: TITO was launched using: RESULT: Template: 2ZYZ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 261 -3391 -12.99 -45.82 target 2D structure prediction score : 0.26 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : -12.99 2D Compatibility (Sec. Struct. Predict.) : 0.26 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.346

(partial model without unconserved sides chains): PDB file : Tito_2ZYZ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2ZYZ-query.scw PDB file : Tito_Scwrl_2ZYZ.pdb: