Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKMLAQLQNRFDQWVEQIVQYLDRLSVRERIMVVFTTIFVVVVIVGYSLWKMHSLAEQQQKRLNDLKDLMVWMQSNAVTMKPANELELDKSGKIQRVAQQQGLTVSSQQNGEQ-LQIVVTHQNYAILANFLIQLA-QMGLSIQKMEMVSSEGQIKLTATV 1UV7 Chain:A ((86-160)) ---------------------------------------------------------------------------------------QPLNQVITNSTRQFNIELIRVQPRGEMMQVWIQPLPFSQLVSWIAYLQERQGVSVDAIDIDRG--VVEVKRLQ

General information: TITO was launched using: RESULT: Template: 1UV7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 215 -14415 -67.05 -208.91 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain A : 0.54 3D Compatibility (PKB) : -67.05 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.54 QMean score : 0.494

(partial model without unconserved sides chains): PDB file : Tito_1UV7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1UV7-query.scw PDB file : Tito_Scwrl_1UV7.pdb: